Recombinant Human Guanylate cyclase activator 2B (GUCA2B) | CSB-EP613693HU

Recombinant Human Guanylate cyclase activator 2B (GUCA2B) | CSB-EP613693HU | Cusabio

Alternative Name(s): Guanylate cyclase C-activating peptide II ;GCAP-IIUroguanylin ;UGN

Gene Names: GUCA2B

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 27-112aa

Sequence Info: Full Length of Mature Protein

MW: 25.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.

Reference: Cloning and characterization of a cDNA encoding a precursor for human uroguanylin.Miyazato M., Nakazato M., Yamaguchi H., Date Y., Kojima M., Kangawa K., Matsuo H., Matsukura S.Biochem. Biophys. Res. Commun. 219:644-648(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Guanylin family

Tissue Specificity: Stomach and intestine.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q16661

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM