Recombinant Human Growth-regulated alpha protein (CXCL1) | CSB-EP006239HU

Recombinant Human Growth-regulated alpha protein (CXCL1) | CSB-EP006239HU | Cusabio

Alternative Name(s): C-X-C motif chemokine 1;GRO-alpha(1-73)Melanoma growth stimulatory activity ;MGSANeutrophil-activating protein 3 ;NAP-3

Gene Names: CXCL1

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 35-107aa

Sequence Info: Full Length of Mature Protein

MW: 11.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has chotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chotactic activity.

Reference: Constitutive overexpression of a growth-regulated gene in transformed Chinese hamster and human cells.Anisowicz A., Bardwell L., Sager R.Proc. Natl. Acad. Sci. U.S.A. 84:7188-7192(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine alpha (chemokine CxC) family

Tissue Specificity:

Paythway: Chemokinesignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P09341

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM