Recombinant Human Growth/differentiation factor 8 (MSTN) | CSB-EP015057HU

(No reviews yet) Write a Review
SKU:
CSB-EP015057HU
Availability:
3 - 7 Working Days
  • Recombinant Human Growth/differentiation factor 8 (MSTN)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Growth/differentiation factor 8 (MSTN) | CSB-EP015057HU | Cusabio

Alternative Name(s): Myostatin

Gene Names: MSTN

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 267-375aa

Sequence Info: Full Length of Mature Protein

MW: 16.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Acts specifically as a negative regulator of skeletal muscle growth.

Reference: Double muscling in cattle due to mutations in the myostatin gene.McPherron A.C., Lee S.-J.Proc. Natl. Acad. Sci. U.S.A. 94:12457-12461(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Acts specifically as a negative regulator of skeletal muscle growth.

Involvement in disease: Muscle hypertrophy (MSLHP)

Subcellular Location: Secreted

Protein Families: TGF-beta family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O14793

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose