Recombinant Human Growth/differentiation factor 2 (GDF2), partial | CSB-YP892325HU1

(No reviews yet) Write a Review
SKU:
CSB-YP892325HU1
Availability:
3 - 7 Working Days
  • Recombinant Human Growth/differentiation factor 2 (GDF2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£209.60 - £754.40

Description

Recombinant Human Growth/differentiation factor 2 (GDF2), partial | CSB-YP892325HU1 | Cusabio

Alternative Name(s): Bone morphogenetic protein 9 Short name: BMP-9

Gene Names: GDF2

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 300-429aa

Sequence Info: Partial

MW: 16.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Potent circulating inhibitor of angiogenesis. Could be involved in bone formation. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.

Reference: "Bone morphogenetic protein-9 is a circulating vascular quiescence factor."David L., Mallet C., Keramidas M., Lamande N., Gasc J.M., Dupuis-Girod S., Plauchu H., Feige J.J., Bailly S.Circ. Res. 102:914-922(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.

Involvement in disease: Telangiectasia, hereditary hemorrhagic, 5 (HHT5)

Subcellular Location: Secreted

Protein Families: TGF-beta family

Tissue Specificity: Detected in blood plasma (at protein level).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UK05

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose