Recombinant Human Group XIIA secretory phospholipase A2 (PLA2G12A), partial | CSB-YP863638HU

(No reviews yet) Write a Review
SKU:
CSB-YP863638HU
Availability:
25 - 35 Working Days
  • Recombinant Human Group XIIA secretory phospholipase A2 (PLA2G12A), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£209.60 - £754.40

Description

Recombinant Human Group XIIA secretory phospholipase A2 (PLA2G12A), partial | CSB-YP863638HU | Cusabio

Alternative Name(s): Phosphatidylcholine 2-acylhydrolase 12A

Gene Names: PLA2G12A

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEE

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 23-185aa

Sequence Info: Partial

MW: 20.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.

Reference: Cloning and recombinant expression of a structurally novel human secreted phospholipase A2.Gelb M.H., Valentin E., Ghomashchi F., Lazdunski M., Lambeau G.J. Biol. Chem. 275:39823-39826(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.

Involvement in disease:

Subcellular Location: Secreted, Cytoplasm

Protein Families: Phospholipase A2 family

Tissue Specificity: Abundantly expressed in heart, skeletal muscle, kidney, liver and pancreas.

Paythway: Vascularsmoothmusclecontraction

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BZM1

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose