Recombinant Human Group XIIA secretory phospholipase A2 (PLA2G12A) | CSB-BP863638HU(A4)

(No reviews yet) Write a Review
SKU:
CSB-BP863638HU(A4)
Availability:
28 - 38 Working Days
£324.80 - £1,061.60

Description

Recombinant Human Group XIIA secretory phospholipase A2 (PLA2G12A) | CSB-BP863638HU(A4) | Cusabio

Alternative Name(s): Phosphatidylcholine 2-acylhydrolase 12A (GXII sPLA2) (sPLA2-XII) (PLA2G12)

Gene Names: PLA2G12A

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 23-189aa

Sequence Info: Full Length of Mature Protein

MW: 22.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.

Reference: "Cloning and recombinant expression of human group IIF-secreted phospholipase A(2)." Valentin E., Singer A.G., Ghomashchi F., Lazdunski M., Gelb M.H., Lambeau G. Biochem. Biophys. Res. Commun. 279:223-228(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BZM1

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose