Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial | CSB-EP006046HU

(No reviews yet) Write a Review
SKU:
CSB-EP006046HU
Availability:
13 - 23 Working Days
  • Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial | CSB-EP006046HU | Cusabio

Alternative Name(s): CDw116; CD116

Gene Names: CSF2RA

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 23-320aa

Sequence Info: Extracellular Domain

MW: 50.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hatopoietic cells.

Reference: Cloning and sequencing of the cDNA variant with 397 bp missing for the GM-CSF receptor alpha subunit.Hu X., Zuckerman K.S.Discovery and characterization of a novel splice variant of the GM-CSF receptor alpha subunit.Pelley J.L., Nicholls C.D., Beattie T.L., Brown C.B.Exp. Hematol. 35:1483-1494(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.

Involvement in disease: Pulmonary surfactant metabolism dysfunction 4 (SMDP4)

Subcellular Location: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted

Protein Families: Type I cytokine receptor family, Type 5 subfamily

Tissue Specificity:

Paythway: Jak-STATsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P15509

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose