Cusabio Human Recombinants
Recombinant Human Glutathione peroxidase 1 (GPX1) | CSB-EP009866HU
- SKU:
- CSB-EP009866HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Glutathione peroxidase 1 (GPX1) | CSB-EP009866HU | Cusabio
Alternative Name(s): Cellular glutathione peroxidase
Gene Names: GPX1
Research Areas: Cancer
Organism: Homo sapiens (Human)
AA Sequence: MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLSGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-203aa
Sequence Info: Full Length
MW: 26.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Protects the hoglobin in erythrocytes from oxidative breakdown.
Reference: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Protects the hemoglobin in erythrocytes from oxidative breakdown.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: Glutathione peroxidase family
Tissue Specificity:
Paythway: Th17celldifferentiation
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P07203
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM