Recombinant Human Glutaredoxin-2, mitochondrial (GLRX2) | CSB-EP878876HU

(No reviews yet) Write a Review
SKU:
CSB-EP878876HU
Availability:
13 - 23 Working Days
  • Recombinant Human Glutaredoxin-2, mitochondrial (GLRX2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Glutaredoxin-2, mitochondrial (GLRX2) | CSB-EP878876HU | Cusabio

Alternative Name(s): bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2); bA101E13.1; CGI133; Glrx2; GLRX2_HUMAN; Glutaredoxin-2; Glutaredoxin-2; mitochondrial; GRX2; mitochondrial

Gene Names: GLRX2

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-124aa

Sequence Info: Full Length of BC028113

MW: 41.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.

Reference: "Cellular and plasma levels of human glutaredoxin 1 and 2 detected by sensitive ELISA systems." Lundberg M., Fernandes A.P., Kumar S., Holmgren A. Biochem. Biophys. Res. Commun. 319:801-809(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.

Involvement in disease:

Subcellular Location: Isoform 1: Mitochondrion, SUBCELLULAR LOCATION: Isoform 2: Nucleus

Protein Families: Glutaredoxin family

Tissue Specificity: Widely expressed. Expressed in brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta and lung. Not expressed in peripheral blood leukocytes.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9NS18

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose