Recombinant Human Glutaminase kidney isoform, mitochondrial (GLS), partial | CSB-EP009528HU(F1)

(No reviews yet) Write a Review
SKU:
CSB-EP009528HU(F1)
Availability:
13 - 23 Working Days
  • Recombinant Human Glutaminase kidney isoform, mitochondrial (GLS), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Human Glutaminase kidney isoform, mitochondrial (GLS), partial | CSB-EP009528HU(F1) | Cusabio

Alternative Name(s): K-glutaminase L-glutamine amidohydrolase

Gene Names: GLS

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 616-669aa

Sequence Info: Partial

MW: 33.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity.

Reference: "Cloning and analysis of unique human glutaminase isoforms generated by tissue-specific alternative splicing."Elgadi K.M., Meguid R.A., Qian M., Souba W.W., Abcouwer S.F.Physiol. Genomics 1:51-62(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity.

Involvement in disease:

Subcellular Location: Isoform 1: Cytoplasm, cytosol, SUBCELLULAR LOCATION: Isoform 3: Mitochondrion

Protein Families: Glutaminase family

Tissue Specificity: Isoform 1 and isoform 3 are detected in brain cortex. Isoform 3 is highly expressed in astrocytoma, ganglioglioma and ependymoma. Isoform 1 is highly expressed in brain and kidney, but not detected in liver. Isoform 3 is highly expressed in heart and pancreas, detected at lower levels in placenta, lung, pancreas and kidney, but is not detected in liver. Isoform 2 is expressed in cardiac and skeletal muscle.

Paythway: Glutamatergicsynapse

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O94925

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose