- Home
- Research Recombinants
- Recombinant Human Glucocorticoid receptor (NR3C1), partial | CSB-EP016059HU1c2
Cusabio Human Recombinants
Recombinant Human Glucocorticoid receptor (NR3C1), partial | CSB-EP016059HU1c2
- SKU:
- CSB-EP016059HU1c2
- UPC:
- MPN:
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Glucocorticoid receptor (NR3C1), partial | CSB-EP016059HU1c2 | Cusabio
Alternative Name(s): Nuclear receptor subfamily 3 group C member 1 GRL
Gene Names: NR3C1
Research Areas: Epigenetics and Nuclear Signaling
Organism: Homo sapiens (Human)
AA Sequence: VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
Source: E.coli
Tag Info: N-terminal 6xHis-Trx-tagged
Expression Region: 521-777aa
Sequence Info: Partial
MW: 47.8 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Involved in chromatin remodeling. Plays a role in rapid mRNA degradation by binding to the 5' UTR of target mRNAs and interacting with PNRC2 in a ligand-dependent manner which recruits the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth
Reference: "A new transcript splice variant of the human glucocorticoid receptor: identification and tissue distribution of hGR Delta 313-338, an alternative exon 2 transactivation domain isoform." Turner J.D., Schote A.B., Keipes M., Muller C.P. Ann. N. Y. Acad. Sci. 1095:334-341(2007)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Receptor for glucocorticoids (GC)
Involvement in disease: Glucocorticoid resistance, generalized (GCCR)
Subcellular Location: Isoform Alpha: Cytoplasm, Nucleus, Mitochondrion, Cytoplasm, cytoskeleton, spindle, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Note=After ligand activation, translocates from the cytoplasm to the nucleus, SUBCELLULAR LOCATION: Isoform Beta: Nucleus, Cytoplasm, Note=Expressed predominantly in the nucleus with some expression also detected in the cytoplasm, SUBCELLULAR LOCATION: Isoform Alpha-B: Nucleus, Cytoplasm
Protein Families: Nuclear hormone receptor family, NR3 subfamily
Tissue Specificity: Widely expressed including bone, stomach, lung, liver, colon, breast, ovary, pancreas and kidney (PubMed:25847991). In the heart, detected in left and right atria, left and right ventricles, aorta, apex, intraventricular septum, and atrioventricular node as well as whole adult and fetal heart (PubMed:10902803). Isoform Beta: Widely expressed including brain, bone marrow, thymus, spleen, liver, kidney, pancreas, lung, fat, skeletal muscle, heart, placenta and blood leukocytes (PubMed:7769088, PubMed:8621628). Isoform Alpha-2: Expressed at low level.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P04150
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM
Related Products

Recombinant Human Glucocorticoid receptor (NR3C1), partial | CSB-EP016059HU1
Cusabio Human Recombinants

Recombinant Human Substance-P receptor (TACR1), partial | CSB-EP023068HU
Cusabio Human Recombinants

Recombinant Human Follicle-stimulating hormone receptor (FSHR), partial | CSB-MP009021HU
Cusabio Human Recombinants

Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial | CSB-MP009438HU1
Cusabio Human Recombinants

Human Glucocorticoid receptor (NR3C1) ELISA kit | CSB-EL016059HU
Cusabio Elisa
Customers Also Viewed

Recombinant Human Parathyroid hormone 2 receptor (PTH2R), partial | CSB-EP018990HU
Cusabio Human Recombinants

Recombinant Human Glucocorticoid receptor (NR3C1), partial | CSB-EP016059HU1
Cusabio Human Recombinants

Recombinant Human Androgen receptor (AR), partial | CSB-EP001975HU
Cusabio Human Recombinants

VSV-G-Tag Monoclonal Antibody | CSB-MA000161
Cusabio Tag & Control

Rabbit anti-Sheep IgG Antibody | CSB-PA00110E1Rb
Cusabio Secondary Antibodies

Rabbit anti-Chicken Yolk Immunoglobulin Antibody;FITC conjugated | CSB-PA00410G0Rb
Cusabio Secondary Antibodies

Rabbit anti-Chicken Yolk Immunoglobulin Antibody;Biotin conjugated | CSB-PA00410H0Rb
Cusabio Secondary Antibodies

Rabbit anti-Chicken Yolk Immunoglobulin Antibody | CSB-PA00410E0Rb
Cusabio Secondary Antibodies

Rabbit anti-Goat IgG Fc Antibody;Biotin conjugated | CSB-PA00570H0Rb
Cusabio Secondary Antibodies

Rabbit anti-Goat IgG Fc Antibody;HRP conjugated | CSB-PA00570F0Rb
Cusabio Secondary Antibodies

Goat Anti-Rabbit IgG(H+L) Antibody; HRP conjugated | CSB-PA564648
Cusabio Secondary Antibodies

MET Antibody | CSB-RA634199A0HU
Cusabio Recombinant Antibodies

HSF1 Antibody | CSB-RA279005A0HU
Cusabio Recombinant Antibodies

ABAT Antibody | CSB-RA242969A0HU
Cusabio Recombinant Antibodies

AKR1C3 Antibody | CSB-RA825204A0HU
Cusabio Recombinant Antibodies

RHOA Antibody | CSB-RA546523A0HU
Cusabio Recombinant Antibodies

FGFR2 Antibody | CSB-RA154582A0HU
Cusabio Recombinant Antibodies

ESR1 Antibody | CSB-RA942338A0HU
Cusabio Recombinant Antibodies

RPTOR Antibody | CSB-RA581950A0HU
Cusabio Recombinant Antibodies

CEACAM1 Antibody | CSB-RA147192A0HU
Cusabio Recombinant Antibodies

GSK3B Antibody | CSB-RA216259A0HU
Cusabio Recombinant Antibodies

SIRT1 Antibody | CSB-RA556800A0HU
Cusabio Recombinant Antibodies

NONO Antibody | CSB-RA273277A0HU
Cusabio Recombinant Antibodies

RPS6KB1 Antibody | CSB-RA299200A0HU
Cusabio Recombinant Antibodies

MAPK14 Antibody | CSB-RA582884A0HU
Cusabio Recombinant Antibodies

CDK2 Antibody | CSB-RA961467A0HU
Cusabio Recombinant Antibodies

CASP3 Antibody | CSB-RA241798A0HU
Cusabio Recombinant Antibodies

CASP3 Antibody | CSB-RA286668A0HU
Cusabio Recombinant Antibodies

CD47 Antibody | CSB-RA802124A0HU
Cusabio Recombinant Antibodies

BCHE Antibody | CSB-RA252650A0HU
Cusabio Recombinant Antibodies

CD80 Antibody | CSB-RA246383A0HU
Cusabio Recombinant Antibodies

ACLY Antibody | CSB-RA712206A0HU
Cusabio Recombinant Antibodies

ATF4 Antibody | CSB-RA002272A0HU
Cusabio Recombinant Antibodies

ARNT Antibody | CSB-RA002121A0HU
Cusabio Recombinant Antibodies

Phospho-SNCA (S129) Antibody | CSB-RA021912A129phHU
Cusabio Recombinant Antibodies

Acetyl-Histone H2B type 1-B(K20)Antibody | CSB-RA010402A20acHU
Cusabio Recombinant Antibodies

Acetyl-Histone H3.1(K56)Antibody | CSB-RA010418A56acHU
Cusabio Recombinant Antibodies

Histone H3.3 Antibody | CSB-RA010109A0HU
Cusabio Recombinant Antibodies

Phospho-Histone H1.4 (T17) Antibody | CSB-RA010380A17phHU
Cusabio Recombinant Antibodies

CD45 Antibody | CSB-RA019049A0HU
Cusabio Recombinant Antibodies

Phospho-Histone H3.3 (T3) Antibody | CSB-RA010109A03phHU
Cusabio Recombinant Antibodies

VPS26A Antibody, Biotin conjugated | CSB-PA025898LD01HU
Cusabio Polyclonal Antibodies

SUMF2 Antibody, Biotin conjugated | CSB-PA839844LD01HU
Cusabio Polyclonal Antibodies

SRC Antibody, FITC conjugated | CSB-PA022650LC11HU
Cusabio Polyclonal Antibodies

SRC Antibody, HRP conjugated | CSB-PA022650LB11HU
Cusabio Polyclonal Antibodies

SRC Antibody | CSB-PA022650LA11HU
Cusabio Polyclonal Antibodies

SRC Antibody, HRP conjugated | CSB-PA022650LB01HU
Cusabio Polyclonal Antibodies

PIBF1 Antibody, HRP conjugated | CSB-PA845171LB01HU
Cusabio Polyclonal Antibodies

PCDHA10 Antibody, HRP conjugated | CSB-PA897505LB11HU
Cusabio Polyclonal Antibodies

PCDHA10 Antibody, HRP conjugated | CSB-PA897505LB01HU
Cusabio Polyclonal Antibodies