Recombinant Human Glial cell line-derived neurotrophic factor (GDNF) | CSB-EP009356HU

Recombinant Human Glial cell line-derived neurotrophic factor (GDNF) | CSB-EP009356HU | Cusabio

Alternative Name(s): Astrocyte-derived trophic factor ;ATF

Gene Names: GDNF

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 78-211aa

Sequence Info: Full Length of Mature Protein

MW: 31.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.

Reference: GDNF a glial cell line-derived neurotrophic factor for midbrain dopaminergic neurons.Lin L.-F.H., Doherty D.H., Lile J.D., Bektesh S., Collins F.Science 260:1130-1132(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.

Involvement in disease: Hirschsprung disease 3 (HSCR3); Congenital central hypoventilation syndrome (CCHS); Pheochromocytoma (PCC)

Subcellular Location: Secreted

Protein Families: TGF-beta family, GDNF subfamily

Tissue Specificity: In the brain, predominantly expressed in the striatum with highest levels in the caudate and lowest in the putamen. Isoform 2 is absent from most tissues except for low levels in intestine and kidney. Highest expression of isoform 3 is found in pancreatic islets. Isoform 5 is expressed at very low levels in putamen, nucleus accumbens, prefrontal cortex, amygdala, hypothalamus and intestine. Isoform 3 is up-regulated in the middle temporal gyrus of Alzheimer disease patients while isoform 2 shows no change.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P39905

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM