Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial | CSB-BP009438HU1

(No reviews yet) Write a Review
SKU:
CSB-BP009438HU1
Availability:
3 - 7 Working Days
£354.40 - £1,177.60

Description

Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial | CSB-BP009438HU1 | Cusabio

Alternative Name(s): Glucose-dependent insulinotropic polypeptide receptor (GIP-R)

Gene Names: GIPR

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 22-138aa

Sequence Info: Partial

MW: 17.3

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase

Reference: "Molecular cloning, functional expression, and signal transduction of the GIP-receptor cloned from a human insulinoma." Volz A., Goke R., Lankat-Buttgereit B., Fehmann H.C., Bode H.P., Goke B. FEBS Lett. 373:23-29(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P48546

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose