Recombinant Human Gamma-soluble NSF attachment protein (NAPG) | CSB-EP860352HU

Recombinant Human Gamma-soluble NSF attachment protein (NAPG) | CSB-EP860352HU | Cusabio

Alternative Name(s): N-ethylmaleimide-sensitive factor attachment protein gamma

Gene Names: NAPG

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENDERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-312aa

Sequence Info: Full Length of BC001889

MW: 61.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.

Reference: "Regulated secretion in platelets: identification of elements of the platelet exocytosis machinery." Lemons P.P., Chen D., Bernstein A.M., Bennett M.K., Whiteheart S.W. Blood 90:1490-1500(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.

Involvement in disease:

Subcellular Location: Membrane, Peripheral membrane protein

Protein Families: SNAP family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99747

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM