Recombinant Human Gamma-secretase subunit APH-1A (APH1a), partial | CSB-CF853390HU

(No reviews yet) Write a Review
SKU:
CSB-CF853390HU
Availability:
18 - 23 Working Days
  • Recombinant Human Gamma-secretase subunit APH-1A (APH1a), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$772.80 - $1,082.40

Description

Recombinant Human Gamma-secretase subunit APH-1A (APH1a), partial | CSB-CF853390HU | Cusabio

Alternative Name(s): Aph-1alpha Presenilin-stabilization factor

Gene Names: APH1a

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRR

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-247aa

Sequence Info: Partial

MW: 42.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein). It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex.

Reference: "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.Genome Res. 10:703-713(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Non-catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein)

Involvement in disease:

Subcellular Location: Endoplasmic reticulum membrane, Multi-pass membrane protein, Golgi apparatus, Golgi stack membrane, Multi-pass membrane protein

Protein Families: APH-1 family

Tissue Specificity: Widely expressed. Expressed in leukocytes, lung, placenta, small intestine, liver, kidney, spleen thymus, skeletal muscle, heart and brain. Isoform 1 and isoform 2 are nearly expressed at the same level.

Paythway: Notchsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96BI3

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose