Recombinant Human Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2), partial | CSB-EP009147HU

(No reviews yet) Write a Review
SKU:
CSB-EP009147HU
Availability:
3 - 7 Working Days
  • Recombinant Human Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Human Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2), partial | CSB-EP009147HU | Cusabio

Alternative Name(s): GABA(A) receptor subunit beta-2

Gene Names: GABRB2

Research Areas: More proteins and peptides

Organism: Homo sapiens (Human)

AA Sequence: SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGY

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 26-244aa

Sequence Info: Partial

MW: 29.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Ligand-gated chloride channel which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain

Reference: "Role of the beta subunit in determining the pharmacology of human gamma-aminobutyric acid type A receptors." Hadingham K.L., Wingrove P.B., Wafford K.A., Bain C., Kemp J.A., Palmer K.J., Wilson A.W., Wilcox A.S., Sikela J.M., Ragan C.I. Mol. Pharmacol. 44:1211-1218(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P47870

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose