Recombinant Human Gamma-aminobutyric acid receptor-associated protein (GABARAP), partial | CSB-RP054844h

Recombinant Human Gamma-aminobutyric acid receptor-associated protein (GABARAP), partial | CSB-RP054844h | Cusabio

Alternative Name(s): GABA(A) receptor-associated protein;MM46

Gene Names: GABARAP

Research Areas: Transport

Organism: Homo sapiens (Human)

AA Sequence: KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-117aa

Sequence Info: Partial

MW: 40.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore mbrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.

Reference: The human homolog of Saccharomyces cerevisiae Apg7p is a Protein-activating enzyme for multiple substrates including human Apg12p, GATE-16, GABARAP, and MAP-LC3.Tanida I., Tanida-Miyake E., Ueno T., Kominami E.J. Biol. Chem. 276:1701-1706(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.

Involvement in disease:

Subcellular Location: Endomembrane system, Cytoplasm, cytoskeleton, Golgi apparatus membrane, Cytoplasmic vesicle, autophagosome, Cytoplasmic vesicle

Protein Families: ATG8 family

Tissue Specificity: Heart, brain, placenta, liver, skeletal muscle, kidney and pancreas.

Paythway: Autophagy-animal

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O95166

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM