null

Recombinant Human Galectin-8 (LGALS8) (Active) | CSB-EP012894HU

(No reviews yet) Write a Review
SKU:
CSB-EP012894HU
Availability:
3 to 7 Working Days
  • Recombinant Human Galectin-8 (LGALS8) (Active)
  • Recombinant Human Galectin-8 (LGALS8) (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€237.00 - €1,221.00
Frequently bought together:

Description

Recombinant Human Galectin-8 (LGALS8) (Active) | CSB-EP012894HU | Cusabio

Protein Description: Full Length

Alternative Name (s) : Po66 carbohydrate-binding protein

Gene Names: LGALS8

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-317aa

Sequence Info: MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 μg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 μg/ml.

MW: 62.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test.

Relevance: Lectin with a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O00214

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose