Recombinant Human G2/mitotic-specific cyclin-B1 (CCNB1) | CSB-YP004806HU

Recombinant Human G2/mitotic-specific cyclin-B1 (CCNB1) | CSB-YP004806HU | Cusabio

Alternative Name(s): CCNB

Gene Names: CCNB1

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-433aa

Sequence Info: Full Length

MW: 50.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Essential for the control of the cell cycle at the G2/M (mitosis) transition.

Reference: "Cyclin F regulates the nuclear localization of cyclin B1 through a cyclin-cyclin interaction." Kong M., Barnes E.A., Ollendorff V., Donoghue D.J. EMBO J. 19:1378-1388(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Essential for the control of the cell cycle at the G2/M (mitosis) transition.

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome

Protein Families: Cyclin family, Cyclin AB subfamily

Tissue Specificity:

Paythway: p53signalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P14635

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM