Recombinant Human Formimidoyltransferase-cyclodeaminase (FTCD) | CSB-YP009029HU

(No reviews yet) Write a Review
SKU:
CSB-YP009029HU
Availability:
3 - 7 Working Days
€298.00 - €1,708.00

Description

Recombinant Human Formimidoyltransferase-cyclodeaminase (FTCD) | CSB-YP009029HU | Cusabio

Alternative Name(s): Formimidoyltransferase-cyclodeaminase(Formiminotransferase-cyclodeaminase)(FTCD)(LCHC1) [Includes: Glutamate formimidoyltransferase(EC 2.1.2.5)(Glutamate formiminotransferase)(Glutamate formyltransferase); Formimidoyltetrahydrofolate cyclodeaminase(EC 4.3.1.4)(Formiminotetrahydrofolate cyclodeaminase)]

Gene Names: FTCD

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Source: Yeast

Tag Info: C-terminal 6xHis-tagged

Expression Region: 1-541aa

Sequence Info: Full Length

MW: 60 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Folate-dependent enzyme, that displays both transferase and deaminase activity. Serves to channel one-carbon units from formiminoglutamate to the folate pool.; Binds and promotes bundling of vimentin filaments originating from the Golgi.

Reference: "Using a yeast two-hybrid system to identify FTCD as a new regulator for HIF-1alpha in HepG2 cells." Yu Z., Ge Y., Xie L., Zhang T., Huang L., Zhao X., Liu J., Huang G. Cell Signal 26:1560-1566(2014)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O95954

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose