Recombinant Human Forkhead box protein P1 (FOXP1), partial | CSB-EP008841HU

(No reviews yet) Write a Review
SKU:
CSB-EP008841HU
Availability:
13 - 23 Working Days
  • Recombinant Human Forkhead box protein P1 (FOXP1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Forkhead box protein P1 (FOXP1), partial | CSB-EP008841HU | Cusabio

Alternative Name(s): Mac-1-regulated forkhead1

Gene Names: FOXP1

Research Areas: Transcription

Organism: Homo sapiens (Human)

AA Sequence: MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLLQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQ

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-114aa

Sequence Info: Partial

MW: 39.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Transcriptional repressor . Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential . Plays an important role in the specification and differentiation of lung epithelium. Acts cooperatively with FOXP4 to regulate lung secretory epithelial cell fate and regeneration by restricting the goblet cell lineage program; the function may involve regulation of AGR2. Essential transcriptional regulator of B-cell development. Involved in regulation of cardiac muscle cell proliferation. Involved in the columnar organization of spinal motor neurons. Promotes the formation of the lateral motor neuron column (LMC) and the preganglionic motor column (PGC) and is required for respective appropriate motor axon projections. The segment-appropriate generation of spinal chord motor columns requires cooperation with other Hox proteins. Can regulate PITX3 promoter activity; may promote midbrain identity in bryonic st cell-derived dopamine neurons by regulating PITX3. Negatively regulates the differentiation of T follicular helper cells T(FH)s. Involved in maintainance of hair follicle st cell quiescence; the function probably involves regulation of FGF18 . Represses transcription of various pro-apoptotic genes and cooperates with NF-kappa B-signaling in promoting B-cell expansion by inhibition of caspase-dependent apoptosis . Binds to CSF1R promoter elents and is involved in regulation of monocyte differentiation and macrophage functions; repression of CSF1R in monocytes ses to involve NCOR2 as corepressor . Involved in endothelial cell proliferation, tube formation and migration indicative for a role in angiogenesis; the role in neovascularization ses to implicate suppression of SA5B . Can negatively regulate androgen receptor signaling .

Reference: The FOXP1 winged helix transcription factor is a novel candidate tumor suppressor gene on chromosome 3p.Banham A.H., Beasley N., Campo E., Fernandez P.L., Fidler C., Gatter K., Jones M., Mason D.Y., Prime J.E., Trougouboff P., Wood K., Cordell J.L.Cancer Res. 61:8820-8829(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transcriptional repressor

Involvement in disease: Mental retardation with language impairment and autistic features (MRLIAF)

Subcellular Location: Nucleus

Protein Families:

Tissue Specificity: Isoform 8 is specifically expressed in embryonic stem cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9H334

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose