Recombinant Human Fms-related tyrosine kinase 3 ligand (FLT3LG), partial | CSB-EP008734HU1

(No reviews yet) Write a Review
SKU:
CSB-EP008734HU1
Availability:
13 - 23 Working Days
  • Recombinant Human Fms-related tyrosine kinase 3 ligand (FLT3LG), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Fms-related tyrosine kinase 3 ligand (FLT3LG), partial | CSB-EP008734HU1 | Cusabio

Alternative Name(s): SL cytokine

Gene Names: FLT3LG

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 27-184aa

Sequence Info: Extracellular Domain

MW: 33.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Stimulates the proliferation of early hatopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.

Reference: Flt3 ligand structure and unexpected commonalities of helical bundles and cystine knots.Savvides S.N., Boone T., Karplus P.A.Nat. Struct. Biol. 7:486-491(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.

Involvement in disease:

Subcellular Location: Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted

Protein Families:

Tissue Specificity:

Paythway: MAPKsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P49771

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose