Recombinant Human fMet-Leu-Phe receptor (FPR1), partial | CSB-EP008854HU1d1

Recombinant Human fMet-Leu-Phe receptor (FPR1), partial | CSB-EP008854HU1d1 | Cusabio

Alternative Name(s): N-formyl peptide receptor Short name: FPR N-formylpeptide chemoattractant receptor

Gene Names: FPR1

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK

Source: E.coli

Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Expression Region: 306-350aa

Sequence Info: Partial

MW: 34.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system

Reference: "Synthesis and use of a novel N-formyl peptide derivative to isolate a human N-formyl peptide receptor cDNA." Boulay F., Tardif M., Brouchon L., Vignais P. Biochem. Biophys. Res. Commun. 168:1103-1109(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: G-protein coupled receptor 1 family

Tissue Specificity: Neutrophils.

Paythway: Rap1signalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21462

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM