Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1) | CSB-EP819458HU

(No reviews yet) Write a Review
SKU:
CSB-EP819458HU
Availability:
13 - 23 Working Days
  • Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1) | CSB-EP819458HU | Cusabio

Alternative Name(s): 1700007B22Rik; AI850911; Fank1; FANK1_HUMAN; Fibronectin type 3 and ankyrin repeat domains 1; Fibronectin type 3 and ankyrin repeat domains protein 1; Fibronectin type III and ankyrin repeat domains 1; HSD13

Gene Names: FANK1

Research Areas: Developmental Biology

Organism: Homo sapiens (Human)

AA Sequence: MEPQKIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-345aa

Sequence Info: Full Length

MW: 54.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: A new spermatogenesis-related gene.Hu T.H., Miao S.Y., Zhang X.D., Qiao Y., Liang G., Wang L.F. Fank1 is a testis-specific gene encoding a nuclear protein exclusively expressed during the transition from the meiotic to the haploid phase of spermatogenesis.Zheng Z., Zheng H., Yan W.Gene Expr. Patterns 7:777-783(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Through the activation of JUN and AP-1-mediated transcription, may regulate apoptosis.

Involvement in disease:

Subcellular Location: Nucleus, Cytoplasm, cytosol

Protein Families:

Tissue Specificity: Mostly restricted to testis.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8TC84

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose