Cusabio Human Recombinants
Recombinant Human Fibronectin (FN1) | CSB-EP008759HU1
- SKU:
- CSB-EP008759HU1
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Fibronectin (FN1) | CSB-EP008759HU1 | Cusabio
Alternative Name(s): Cold-insoluble globulin (CIG)
Gene Names: FN1
Research Areas: Cancer
Organism: Homo sapiens (Human)
AA Sequence: TASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRSDTVPSPR
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 732-911aa
Sequence Info: Partial of the full length of 723-911AA
MW: 23.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape.
Reference: "Phenotypic and genetic alterations in mammary stroma: implications for tumour progression." Schor S.L., Schor A.M. Breast Cancer Res. 3:373-379(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P02751
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A