Recombinant Human Fibroblast growth factor 8 (FGF8), partial | CSB-EP008637HU1

(No reviews yet) Write a Review
SKU:
CSB-EP008637HU1
Availability:
13 - 23 Working Days
  • Recombinant Human Fibroblast growth factor 8 (FGF8), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Fibroblast growth factor 8 (FGF8), partial | CSB-EP008637HU1 | Cusabio

Alternative Name(s): FGF-8;Androgen-induced growth factor;AIGF;Heparin-binding growth factor 8;HBGF-8

Gene Names: FGF8

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: QEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGK

Source: E.coli

Tag Info: N-terminal 6xHis-GST-tagged

Expression Region: 23-143aa

Sequence Info: Partial

MW: 44.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system (PubMed:16384934, PubMed:16597617, PubMed:8663044). Plays a role in neurite outgrowth in hippocampal cells (PubMed:21576111).

Reference: "Senataxin modulates neurite growth through fibroblast growth factor 8 signalling." Vantaggiato C., Bondioni S., Airoldi G., Bozzato A., Borsani G., Rugarli E.I., Bresolin N., Clementi E., Bassi M.T. Brain 134:1808-1828(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55075

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose