Recombinant Human Fibroblast growth factor 7 (FGF7), partial | CSB-EP008634HU1

Recombinant Human Fibroblast growth factor 7 (FGF7), partial | CSB-EP008634HU1 | Cusabio

Alternative Name(s): Heparin-binding growth factor 7

Gene Names: FGF7

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: DMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFL

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

Expression Region: 34-189aa

Sequence Info: Partial

MW: 32.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.

Reference: "Human KGF is FGF-related with properties of a paracrine effector of epithelial cell growth." Finch P.W., Rubin J.S., Miki T., Ron D., Aaronson S.A. Science 245:752-755(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Heparin-binding growth factors family

Tissue Specificity: Epithelial cell.

Paythway: MAPKsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21781

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM