Recombinant Human Fibroblast growth factor 12 (FGF12) (Active) | CSB-AP004021HU

(No reviews yet) Write a Review
SKU:
CSB-AP004021HU
Availability:
5 to 10 Working Days
  • Recombinant Human Fibroblast growth factor 12 (FGF12) (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€200.00 - €376.00

Description

Recombinant Human Fibroblast growth factor 12 (FGF12) (Active) | CSB-AP004021HU | Cusabio

Protein Description: Full Length of Isoform 2

Alternative Name (s) : Fibroblast Growth Factor 12; FGF-12; Fibroblast Growth Factor Homologous Factor 1; FHF-1; Myocyte-Activating Factor; FGF12; FGF12B; FHF1

Gene Names: FGF12

Research Areas: Cardiovascular

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 1-181aa

Sequence Info: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Biological Activity: The ED50 as determined by its ability to bind Human FGF R3 in functional ELISA is less than 20 ug/ml.

MW: 20.45 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Fibroblast Growth Factor 12 (FGF-12) is a member of the fibroblast growth factor (FGF) family. FGF-12 is probably involved in nervous system development and function. FGF-12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfectedinto mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 5 mM EDTA, pH 7.5

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P61328-2

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose