Recombinant Human Fibroblast growth factor 1 protein (FGF1) (Active) | CSB-AP002391HU

(No reviews yet) Write a Review
SKU:
CSB-AP002391HU
Availability:
5 to 10 Working Days
  • Recombinant Human Fibroblast growth factor 1 protein (FGF1) (Active)
  • Recombinant Human Fibroblast growth factor 1 protein (FGF1) (Active) | CSB-AP002391HU
€192.00 - €951.00

Description

Recombinant Human Fibroblast growth factor 1 protein (FGF1) (Active) | CSB-AP002391HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : FGF-1, aFGF, Endothelial cell growth factor, ECGF, Heparin-binding growth factor 1

Gene Names: FGF1,FGFA

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: E.Coli

Tag Info: Tag-Free

Expression Region: 16-155aa

Sequence Info: M+FNLPPGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SVGEVYIKST ETGQYLAMDTDGLLYGSQTPNEECLFLERL EENHYNTYIS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D

Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 106 IU/mg in the presence of 10 μg/ml of heparin.

MW: 16.0 kDa

Purity: >95% as determined by SDS-PAGE and HPLC.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. {ECO:0000269|PubMed:16597617, ECO:0000269|PubMed:20145243, ECO:0000269|PubMed:8663044}.

PubMed ID: 3523756; 2590193; 2474753; 1693186; 1717925; 1372643; 7504343; 14702039; 15372022; 15489334; 2393407; 2427112; 3527167; 3778488; 3964259; 3732516; 1885605; 8663044; 11432880; 11964394; 16597617; 18400376; 20863990; 15863030; 20094046; 22321063; 1702556; 8652550; 9655399; 10830168; 11069186; 10618369; 11847269; 14732692; 7521397; 8950275; 9719643; 20145243; 20220137

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV

Involvement in disease:

Subcellular Location: Secreted, Cytoplasm, Cytoplasm, cell cortex, Cytoplasm, cytosol, Nucleus

Protein Families: Heparin-binding growth factors family

Tissue Specificity: Predominantly expressed in kidney and brain. Detected at much lower levels in heart and skeletal muscle.

Paythway: Hipposignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P05230

Uniprot Entry Name: FGF1_HUMAN

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose