Recombinant Human Fibrinogen-like protein 1 (FGL1) | CSB-MP008653HU

Recombinant Human Fibrinogen-like protein 1 (FGL1) | CSB-MP008653HU | Cusabio

Alternative Name(s): HP-041 (HPS) (Hepatocyte-derived fibrinogen-related protein 1) (HFREP-1) (Liver fibrinogen-related protein 1) (LFIRE-1) (HFREP1)

Gene Names: FGL1

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Source: Mammalian cell

Tag Info: C-terminal hFc-Myc-tagged

Expression Region: 23-312aa

Sequence Info: Full Length of Mature Protein

MW: 64.1

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Immune suppressive molecule that inhibits antigen-specific T-cell activation by acting as a major ligand of LAG3 . Responsible for LAG3 T-cell inhibitory function . Binds LAG3 independently from MHC class II . In addition to its role in inhibiting inflammatory immune responses, also plays a role in hepatocytes . Under normal physiological conditions, primarily secreted from hepatocytes and contributes to its mitogenic and metabolic functions .

Reference: "Molecular cloning and functional expression analysis of a cDNA for human hepassocin, a liver-specific protein with hepatocyte mitogenic activity." Hara H., Yoshimura H., Uchida S., Toyoda Y., Aoki M., Sakai Y., Morimoto S., Shiokawa K. Biochim. Biophys. Acta 1520:45-53(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q08830

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A