Cusabio Human Recombinants
Recombinant Human Fatty acid-binding protein (FABP5) | CSB-EP007946HUe0
- SKU:
- CSB-EP007946HUe0
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Fatty acid-binding protein (FABP5) | CSB-EP007946HUe0 | Cusabio
Alternative Name(s): Epidermal-type fatty acid-binding protein
Gene Names: FABP5
Research Areas: Cardiovascular
Organism: Homo sapiens (Human)
AA Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-135aa
Sequence Info: Full Length
MW: 42.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.
Reference: "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: Calycin superfamily, Fatty-acid binding protein (FABP) family
Tissue Specificity: Keratinocytes; highly expressed in psoriatic skin.
Paythway: PPARsignalingpathway
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q01469
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM