Recombinant Human Excitatory amino acid transporter 4 (SLC1A6), partial | CSB-EP021437HU

(No reviews yet) Write a Review
SKU:
CSB-EP021437HU
Availability:
13 - 23 Working Days
  • Recombinant Human Excitatory amino acid transporter 4 (SLC1A6), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$319.20 - $1,728.00

Description

Recombinant Human Excitatory amino acid transporter 4 (SLC1A6), partial | CSB-EP021437HU | Cusabio

Alternative Name(s): Sodium-dependent glutamate/aspartate transporter Solute carrier family 1 member 6

Gene Names: SLC1A6

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 149-271aa

Sequence Info: Partial

MW: 40.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Transports L-glutamate and also L- and D-aspartate. Seems to act as a symport by cotransporting sodium.

Reference: "An excitatory amino-acid transporter with properties of a ligand-gated chloride channel."Fairman W.A., Vandenberg R.J., Arriza J.L., Kavanaugh M.P., Amara S.G.Nature 375:599-603(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A6 subfamily

Tissue Specificity: Brain. Expressed densely and selectively in cell bodies of Purkinje cells.

Paythway: Glutamatergicsynapse

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P48664

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose