Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 3 (EIF4EBP3) | CSB-EP007565HU

(No reviews yet) Write a Review
SKU:
CSB-EP007565HU
Availability:
13 - 23 Working Days
  • Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 3 (EIF4EBP3)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 3 (EIF4EBP3) | CSB-EP007565HU | Cusabio

Alternative Name(s): EIF4EBP3Eukaryotic translation initiation factor 4E-binding protein 3; 4E-BP3; eIF4E-binding protein 3

Gene Names: EIF4EBP3

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-100aa

Sequence Info: Full Length

MW: 26.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Repressor of translation initiation that regulates EIF4E activity by preventing its assbly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation.

Reference: 4E-BP3, a new member of the eukaryotic initiation factor 4E-binding protein family.Poulin F., Gingras A.-C., Olsen H., Chevalier S., Sonenberg N.J. Biol. Chem. 273:14002-14007(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex

Involvement in disease:

Subcellular Location:

Protein Families: EIF4E-binding protein family

Tissue Specificity: Expression is highest in skeletal muscle, heart, kidney, and pancreas, whereas there is very little expression in brain and thymus.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O60516

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose