Recombinant Human Eukaryotic translation initiation factor 1 (EIF1) | CSB-RP051144h

Recombinant Human Eukaryotic translation initiation factor 1 (EIF1) | CSB-RP051144h | Cusabio

Alternative Name(s): A121;Protein translation factor SUI1 homologSui1iso1

Gene Names: EIF1

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-113aa

Sequence Info: Full Length

MW: 39.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Necessary for scanning and involved in initiation site selection. Promotes the assbly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.

Reference: Novel Upf2p orthologues suggest a functional link between translation initiation and nonsense surveillance complexes.Mendell J.T., Medghalchi S.M., Lake R.G., Noensie E.N., Dietz H.C.Mol. Cell. Biol. 20:8944-8957(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.

Involvement in disease:

Subcellular Location:

Protein Families: SUI1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P41567

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A