Cusabio Human Recombinants
Recombinant Human Epiplakin (EPPK1) , partial | CSB-EP007745HU
- SKU:
- CSB-EP007745HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Epiplakin (EPPK1) , partial | CSB-EP007745HU | Cusabio
Alternative Name(s): 450KDA epidermal antigen
Gene Names: EPPK1
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MSGHTLPPLPVPGTNSTEQASVPRAMAATLGAGTPPRPQARSIAGVYVEASGQAQSVYAAMEQGLLPAGLGQALLEAQAATGGLVDLARGQLLPVSKALQQGLVGLELKEKLLAAERATTGYPDPYGGEKLALFQAIGKEVVDRALGQSWLEVQLATGGLVDPAQGVLVAPEPACHQGLLDRETWHKLSELEPGTGDLRFLNPNTLERLTYHQLLERCVRAPGSG
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-225aa
Sequence Info: Partial
MW: 27.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Cytoskeletal linker protein that connects to intermediate filaments and controls their reorganization in response to stress
Involvement in disease:
Subcellular Location: Cytoplasm, cytoskeleton, Cell junction, hemidesmosome, Cell junction, tight junction, Cell projection, Apicolateral cell membrane, Basolateral cell membrane, Cell junction
Protein Families: Plakin or cytolinker family
Tissue Specificity: Expressed in epithelial cells of liver, small intestine, colon, salivary glands, stomach and appendix.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P58107
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM