Recombinant Human Enhancer of rudimentary homolog (ERH) | CSB-RP027444h

(No reviews yet) Write a Review
SKU:
CSB-RP027444h
Availability:
13 - 23 Working Days
  • Recombinant Human Enhancer of rudimentary homolog (ERH)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Enhancer of rudimentary homolog (ERH) | CSB-RP027444h | Cusabio

Alternative Name(s): DROER; Enhancer of rudimentary homolog (Drosophila); Enhancer of rudimentary homolog; ERH; ERH_HUMAN; FLJ27340; HGNC:3447

Gene Names: ERH

Research Areas: Cell Cycle

Organism: Homo sapiens (Human)

AA Sequence: SHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-104aa

Sequence Info: Full Length of Mature Protein

MW: 39.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May have a role in the cell cycle.

Reference: Cloning and mapping of a novel human cDNA homologous to DROER, the enhancer of the Drosophila melanogaster rudimentary gene.Isomura M., Okui K., Fujiwara T., Shin S., Nakamura Y.Genomics 32:125-127(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May have a role in the cell cycle.

Involvement in disease:

Subcellular Location:

Protein Families: E(R) family

Tissue Specificity: Expressed in all tissues examined.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P84090

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose