Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29), partial | CSB-RP053444h

(No reviews yet) Write a Review
SKU:
CSB-RP053444h
Availability:
3 - 7 Working Days
  • Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29), partial | CSB-RP053444h | Cusabio

Alternative Name(s): Endoplasmic reticulum resident protein 28 ;ERp28Endoplasmic reticulum resident protein 31 ;ERp31

Gene Names: ERP29

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 40-251aa

Sequence Info: Partial

MW: 51 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Does not se to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.

Reference: ERp28, a human endoplasmic-reticulum-lumenal protein, is a member of the protein disulfide isomerase family but lacks a CXXC thioredoxin-box motif.Ferrari D.M., van Nguyen P., Kratzin H.D., Soeling H.D.Eur. J. Biochem. 255:570-579(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.

Involvement in disease:

Subcellular Location: Endoplasmic reticulum lumen, Melanosome

Protein Families:

Tissue Specificity: Ubiquitous. Mostly expressed in secretory tissues.

Paythway: Proteinprocessinginendoplasmicreticulum

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P30040

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose