Recombinant Human Elafin (PI3) | CSB-YP017952HU

Recombinant Human Elafin (PI3) | CSB-YP017952HU | Cusabio

Alternative Name(s): Elastase-specific inhibitor ;ESIPeptidase inhibitor 3 ;PI-3;Protease inhibitor WAP3Skin-derived antileukoproteinase ;SKALPWAP four-disulfide core domain protein 14

Gene Names: PI3

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 61-117aa

Sequence Info: Full Length of Mature Protein

MW: 8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.

Reference: Primary structure of the human elafin precursor preproelafin deduced from the nucleotide sequence of its gene and the presence of unique repetitive sequences in the prosegment.Saheki T., Ito F., Hagiwara H., Saito Y., Kuroki J., Tachibana S., Hirose S.Biochem. Biophys. Res. Commun. 185:240-245(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19957

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM