Recombinant Human Echinoderm microtubule-associated protein-like 2 (EML2), partial | CSB-EP007643HU

(No reviews yet) Write a Review
SKU:
CSB-EP007643HU
Availability:
13 - 23 Working Days
  • Recombinant Human Echinoderm microtubule-associated protein-like 2 (EML2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Echinoderm microtubule-associated protein-like 2 (EML2), partial | CSB-EP007643HU | Cusabio

Alternative Name(s): 1600029N02Rik; Echinoderm microtubule associated protein like 2; Echinoderm microtubule-associated protein-like 2; Echinoderm MT associated protein like protein 70; ELP70; EMAL2_HUMAN; EMAP-2; EMAP2; EML2; HuEMAP-2

Gene Names: EML2

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-418aa

Sequence Info: Partial

MW: 61.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Tubulin binding protein that inhibits microtubule nucleation and growth, resulting in shorter microtubules.

Reference: Crystal structure of EML1 reveals the basis for Hsp90 dependence of oncogenic EML4-ALK by disruption of an atypical ?-propeller domain.Richards M.W., Law E.W., Rennalls L.P., Busacca S., O'Regan L., Fry A.M., Fennell D.A., Bayliss R.Proc. Natl. Acad. Sci. U.S.A. 111:5195-5200(2014)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Tubulin binding protein that inhibits microtubule nucleation and growth, resulting in shorter microtubules.

Involvement in disease:

Subcellular Location: Cytoplasm, cytoskeleton, Cytoplasm, cytoskeleton, spindle

Protein Families: WD repeat EMAP family

Tissue Specificity: Ubiquitous.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O95834

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose