Cusabio Human Recombinants
Recombinant Human Early growth response protein 1 (EGR1), partial | CSB-EP007484HU
- SKU:
- CSB-EP007484HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Early growth response protein 1 (EGR1), partial | CSB-EP007484HU | Cusabio
Alternative Name(s): AT225 (Nerve growth factor-induced protein A) (NGFI-A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox-24) (KROX24) (ZNF225)
Gene Names: EGR1
Research Areas: Transcription
Organism: Homo sapiens (Human)
AA Sequence: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Source: E.coli
Tag Info: N-terminal 6xHis-B2M-tagged
Expression Region: 444-543aa
Sequence Info: Partial
MW: 24.1 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.
Reference: cDNA sequence of the human cellular early growth response gene Egr-1.Suggs S.V., Katzowitz J.L., Tsai-Morris C.-H., Sukhatme V.P.Nucleic Acids Res. 18:4283-4283(1990)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Transcriptional regulator
Involvement in disease:
Subcellular Location: Nucleus, Cytoplasm
Protein Families: EGR C2H2-type zinc-finger protein family
Tissue Specificity: Detected in neutrophils (at protein level).
Paythway: AGE-RAGEsignalingpathwayindiabeticcomplications
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P18146
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM