Recombinant Human Dysbindin domain-containing protein 2 (DBNDD2) | CSB-EP863102HU

Recombinant Human Dysbindin domain-containing protein 2 (DBNDD2) | CSB-EP863102HU | Cusabio

Alternative Name(s): Casein kinase-1 binding protein ;CK1BPHSMNP1

Gene Names: DBNDD2

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-161aa

Sequence Info: Full Length of Isoform 2

MW: 33.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro).

Reference: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. , Zhou J., Xu S.-H., Gu J., Shi J.-X., Jin W.-R., Zhang C.-K., Wu T.-M., Huang G.-Y., Chen Z., Chen M.-D., Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro).

Involvement in disease:

Subcellular Location:

Protein Families: Dysbindin family

Tissue Specificity: Detected in brain.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BQY9

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM