Recombinant Human Dynamin-1 (DNM1), partial | CSB-EP007062HUa0

Recombinant Human Dynamin-1 (DNM1), partial | CSB-EP007062HUa0 | Cusabio

Alternative Name(s): B dynamin; D100; DNM 1; DNM; DNM1; DYN1_HUMAN; Dynamin; Dynamin-1; Dynamin1

Gene Names: DNM1

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-245aa

Sequence Info: Partial

MW: 32.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis.

Reference: Mutations in human dynamin block an intermediate stage in coated vesicle formation.van der Bliek A.M., Redelmeier T.E., Tisdale E.J., Meyerowitz E.M., Schmid S.L.J. Cell Biol. 122:553-563(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis.

Involvement in disease: Epileptic encephalopathy, early infantile, 31 (EIEE31)

Subcellular Location: Cytoplasm, Cytoplasm, cytoskeleton

Protein Families: TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family

Tissue Specificity:

Paythway: OxidativePhosphorylation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q05193

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM