Recombinant Human Dynactin subunit 3 (DCTN3) | CSB-EP006566HU

Recombinant Human Dynactin subunit 3 (DCTN3) | CSB-EP006566HU | Cusabio

Alternative Name(s): Dynactin complex subunit 22KDA subunit ;p22

Gene Names: DCTN3

Research Areas: Cell Cycle

Organism: Homo sapiens (Human)

AA Sequence: AGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-176aa

Sequence Info: Full Length of Mature Protein of Isoform 2

MW: 35.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Together with dynein may be involved in spindle assbly and cytokinesis.

Reference: Characterization of the p22 subunit of dynactin reveals the localization of Cytoplasmic domain dynein and dynactin to the midbody of dividing cells.Karki S., LaMonte B., Holzbaur E.L.F.J. Cell Biol. 142:1023-1034(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Together with dynein may be involved in spindle assembly and cytokinesis.

Involvement in disease:

Subcellular Location: Cytoplasm, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Chromosome, centromere, kinetochore, Cytoplasm, cytoskeleton, spindle, Cleavage furrow, Midbody

Protein Families: Dynactin subunit 3 family

Tissue Specificity: Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O75935

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM