Recombinant Human Dual specificity protein phosphatase 22 (DUSP22) | CSB-EP865123HU

(No reviews yet) Write a Review
SKU:
CSB-EP865123HU
Availability:
13 - 23 Working Days
  • Recombinant Human Dual specificity protein phosphatase 22 (DUSP22)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Dual specificity protein phosphatase 22 (DUSP22) | CSB-EP865123HU | Cusabio

Alternative Name(s): JNK-stimulatory phosphatase-1

Gene Names: DUSP22

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: GNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-184aa

Sequence Info: Full Length

MW: 47.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK)

Reference: "Activation of the Jnk signaling pathway by a dual-specificity phosphatase, JSP-1." Shen Y., Luche R., Wei B., Gordon M.L., Diltz C.D., Tonks N.K. Proc. Natl. Acad. Sci. U.S.A. 98:13613-13618(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) (By similarity).

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus

Protein Families: Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily

Tissue Specificity: Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9NRW4

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose