Recombinant Human DNA-binding protein inhibitor ID-1 (ID1) | CSB-EP010966HU

(No reviews yet) Write a Review
SKU:
CSB-EP010966HU
Availability:
13 - 23 Working Days
  • Recombinant Human DNA-binding protein inhibitor ID-1 (ID1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human DNA-binding protein inhibitor ID-1 (ID1) | CSB-EP010966HU | Cusabio

Alternative Name(s): Class B basic helix-loop-helix protein 24 ;bHLHb24Inhibitor of DNA binding 1Inhibitor of differentiation 1

Gene Names: ID1

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-155aa

Sequence Info: Full Length

MW: 32.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer .

Reference: Nucleotide sequence of the cDNA encoding human helix-loop-helix Id-1 protein identification of functionally conserved residues common to Id proteins.Deed R.W., Jasiok M., Norton J.D.Biochim. Biophys. Acta 1219:160-162(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer (By similarity).

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus

Protein Families:

Tissue Specificity:

Paythway: Hipposignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P41134

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose