Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial | CSB-EP006852HU1b0

Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial | CSB-EP006852HU1b0 | Cusabio

Alternative Name(s): Dihydroorotate oxidase

Gene Names: DHODH

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 31-395aa

Sequence Info: Partial

MW: 45.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.

Reference: "Recombinant human dihydroorotate dehydrogenase: expression, purification, and characterization of a catalytically functional truncated enzyme." Copeland R.A., Davis J.P., Dowling R.L., Lombardo D., Murphy K.B., Patterson T.A. Arch. Biochem. Biophys. 323:79-86(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.

Involvement in disease: Postaxial acrofacial dysostosis (POADS)

Subcellular Location: Mitochondrion inner membrane, Single-pass membrane protein

Protein Families: Dihydroorotate dehydrogenase family, Type 2 subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q02127

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM