Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial | CSB-EP006852HU1

(No reviews yet) Write a Review
SKU:
CSB-EP006852HU1
Availability:
13 - 23 Working Days
  • Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial | CSB-EP006852HU1 | Cusabio

Alternative Name(s): Dihydroorotate oxidase

Gene Names: DHODH

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 31-395aa

Sequence Info: Partial

MW: 43.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.

Reference: Exome sequencing identifies the cause of a Mendelian disorder.Ng S.B., Buckingham K.J., Lee C., Bigham A.W., Tabor H.K., Dent K.M., Huff C.D., Shannon P.T., Jabs E.W., Nickerson D.A., Shendure J., Bamshad M.J.Nat. Genet. 42:30-35(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.

Involvement in disease: Postaxial acrofacial dysostosis (POADS)

Subcellular Location: Mitochondrion inner membrane, Single-pass membrane protein

Protein Families: Dihydroorotate dehydrogenase family, Type 2 subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q02127

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose