Recombinant Human Diamine acetyltransferase 1 (SAT1), partial | CSB-EP020717HU1

Recombinant Human Diamine acetyltransferase 1 (SAT1), partial | CSB-EP020717HU1 | Cusabio

Alternative Name(s): Polyamine N-acetyltransferase 1;Putrescine acetyltransferase;Spermidine/spermine N(1)-acetyltransferase 1 ;SSAT ;SSAT-1

Gene Names: SAT1

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 5-171aa

Sequence Info: Partial

MW: 46.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine > putrescine. This highly regulated enzyme allows a fine attenuation of the intracellular concentration of polyamines. Also involved in the regulation of polyamine transport out of cells. Acts on 1,3-diaminopropane, 1,5-diaminopentane, putrescine, spermidine (forming N(1)- and N(8)-acetylspermidine), spermine, N(1)-acetylspermidine and N(8)-acetylspermidine.

Reference: Isolation and characterization of a cDNA clone that codes for human spermidine/spermine N1-acetyltransferase.Casero R.A. Jr., Celano P., Ervin S.J., Applegren N.B., Wiest L., Pegg A.E.J. Biol. Chem. 266:810-814(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Enzyme which catalyzes the acetylation of polyamines. Substrate specificity

Involvement in disease: Keratosis follicularis spinulosa decalvans X-linked (KFSDX)

Subcellular Location: Cytoplasm

Protein Families: Acetyltransferase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21673

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM