Recombinant Human Decorin (DCN), partial | CSB-EP006554HU1

Recombinant Human Decorin (DCN), partial | CSB-EP006554HU1 | Cusabio

Alternative Name(s): Bone proteoglycan IIPG-S2;PG40

Gene Names: DCN

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: QQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 20-359aa

Sequence Info: Partial

MW: 41.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May affect the rate of fibrils formation.

Reference: Primary structure of an Extracellular domain matrix proteoglycan core protein deduced from cloned cDNA.Krusius T., Ruoslahti E.Proc. Natl. Acad. Sci. U.S.A. 83:7683-7687(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May affect the rate of fibrils formation.

Involvement in disease: Corneal dystrophy, congenital stromal (CSCD)

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily

Tissue Specificity:

Paythway: TGF-betasignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07585

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM