Recombinant Human Death-associated protein 1 (DAP) | CSB-RP010344h

Recombinant Human Death-associated protein 1 (DAP) | CSB-RP010344h | Cusabio

Alternative Name(s): DAP 1; Dap; DAP-1; DAP1_HUMAN; Death associated protein 1; Death associated protein; Death-associated protein 1; MGC99796; OTTHUMP00000161670; OTTHUMP00000221331

Gene Names: DAP1

Research Areas: Apoptosis

Organism: Homo sapiens (Human)

AA Sequence: SSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-102aa

Sequence Info: Full Length of Mature Protein

MW: 38 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Negative regulator of autophagy. Involved in mediating interferon-gamma-induced cell death.

Reference: Identification of a novel serine/threonine kinase and a novel 15-kD protein as potential mediators of the gamma interferon-induced cell death.Deiss L.P., Feinstein E., Berissi H., Cohen O., Kimchi A.Genes Dev. 9:15-30(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Negative regulator of autophagy. Involved in mediating interferon-gamma-induced cell death.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P51397

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM